SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000297 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000297
Domain Number 1 Region: 577-838
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.23e-90
Family Eukaryotic proteases 0.0000000204
Further Details:      
 
Domain Number 2 Region: 317-430
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-26
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 3 Region: 203-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-20
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 4 Region: 66-149
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000327
Family SEA domain 0.0051
Further Details:      
 
Domain Number 5 Region: 508-544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 436-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 472-509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 548-588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000561
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000297   Gene: ENSMLUG00000000326   Transcript: ENSMLUT00000000326
Sequence length 839
Comment pep:putative scaffold:Myoluc2.0:GL429992:1970391:1988327:-1 gene:ENSMLUG00000000326 transcript:ENSMLUT00000000326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSVQSMHAFEEGLEFLPVNNTKKVEKGGLRPWVVPMVAVLVILLVSLVAGFLVWHFKYR
DVRIQKVFNGYLRVTNENFLDAYENPNSTEFVELASKVKEALKQLYSEIPVLRPYYKEST
VTAFSEGSVIAYYWSEFSIPSHLVEEAERIMAEERAIRLPPRARTLSSFLLTSVVAFPTD
PRTVQTAQDNRCKFALHARWGEQTRFTTPGFPDSPYPAFARCQWTLRGDANSVLSLTFRS
FDVAACDSKGNDLVVVYDTLSPVEPRMVKQLCGTYPASYNLTFISSQNVLLVTLITNTER
RHPGFEAVFFQLPKMSGCGGYLYDDRGTFSSPYYPGHYPPNINCTWQIEVPHNRNVKVSF
KVFYLWEPTVPVGTCPKDYVEVNGENWAPPPGSAGEKSQFVVASKSSRITVRFHSDQSYT
DTGFLAEYLVYDSSDPCPGKFMCNTGRCIGNELRCDGWADCADHSDELDCKCNATYQFTC
KNKFCKPLFWVCDTVNDCGDNSDELECSCPDKNFKCGNGKCIPESQRCDGKDNCGDGSDE
AKCSGGTVVTCTKHTYRCHNGLCLSKTNPECDGKKDCSDGSDEKNCDCGLRAFSRQSRVV
GGKDAEEGEWPWQVSLHGLGQGHVCGASLISPSWMVSAAHCFVDDRGFKYSDHTMWKAFL
GLHDQSKRSVSGVQERGLKRIITHPSFNDFTFDYDIALLELERPVEYSNTVRPICLPDTS
HDFPTGKAIWVTGWGHTYEGGTVVLILQKGEIRIINQTTCEKLLPQQITPRMMCVGYLSG
GVDACQGDSGGPLSSVEADGRIFQAGVVSWGEGCAQRDKPGVYTRLPIFRDWIKEQTGV
Download sequence
Identical sequences G1NT18
ENSMLUP00000000297 ENSMLUP00000000297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]