SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000330 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000330
Domain Number 1 Region: 340-595
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.5e-91
Family Hsp90 middle domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 73-295,333-368
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.63e-70
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000000237
Further Details:      
 
Domain Number 3 Region: 618-744
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 5.62e-32
Family HSP90 C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000330   Gene: ENSMLUG00000000360   Transcript: ENSMLUT00000000362
Sequence length 807
Comment pep:putative scaffold:Myoluc2.0:GL429777:634355:651888:-1 gene:ENSMLUG00000000360 transcript:ENSMLUT00000000362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEETA
KEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFY
KSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFIT
DDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEK
YNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIY
FMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFD
ESEKTKENREALEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNME
RIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFE
TATLRSGYLLPDTKAYGDRIERMLRLSLNIDLDAKVEEEPEEEPEETAEDATEDTDQDED
EDMDAGTDDEDEKAEISKKSSAEKDEL
Download sequence
Identical sequences G1QEA2
ENSMLUP00000022035 ENSMLUP00000000330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]