SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000543 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000543
Domain Number 1 Region: 117-214
Classification Level Classification E-value
Superfamily EF-hand 4.88e-26
Family Eps15 homology domain (EH domain) 0.0000282
Further Details:      
 
Domain Number 2 Region: 264-364
Classification Level Classification E-value
Superfamily EF-hand 7.81e-25
Family Eps15 homology domain (EH domain) 0.0000729
Further Details:      
 
Domain Number 3 Region: 17-105
Classification Level Classification E-value
Superfamily EF-hand 7.15e-17
Family Eps15 homology domain (EH domain) 0.0000908
Further Details:      
 
Domain Number 4 Region: 386-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000915
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000543   Gene: ENSMLUG00000000595   Transcript: ENSMLUT00000000599
Sequence length 909
Comment pep:putative scaffold:Myoluc2.0:GL430047:1017862:1091773:-1 gene:ENSMLUG00000000595 transcript:ENSMLUT00000000599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLTNIWFCLQIPTGNPLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLNMPPPKFHDTSSPLMVTPPSAEAL
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSVLPPSLIPPTKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSIKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLNQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPIPDSSSSLGSGEFTGVKELDDISQEIAQLQREKYTLEQDIREKEEAIRQKTNE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGKVQLETIIKSLKSTQDEI
NQARSKLAQLHESQQEAHRSLEQYDEVLDGAHGASLTNLADLSEGVSLTERGGFGTMDDP
FKNKALLFSNNAQELHPDPFQAEDPFKSDPFKGADPFKGDPFQNDPFAEQQIASTDPFGG
DPFKESDPFRGSAPDDFFKKHTKNDPFSSDPFTKNPSLPSKLDPFESSDPFSSSSVSSRG
SGHFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSFGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSGKSTPVSQLGSADFPDSPDPFQPLGADSSDPFQNKRGFGDPFSGKDP
FAPSSSAKPSKASSLGFADFTSFGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAI
ALSKADMPA
Download sequence
Identical sequences G1NTN9
ENSMLUP00000000543 ENSMLUP00000000543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]