SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000813 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000813
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.78e-56
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 252-446
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000813   Gene: ENSMLUG00000000879   Transcript: ENSMLUT00000000888
Sequence length 876
Comment pep:putative scaffold:Myoluc2.0:GL430930:158500:204446:-1 gene:ENSMLUG00000000879 transcript:ENSMLUT00000000888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQQTFSFLLEMSLFISKRIGRAEKTEVLSEDLLQIERRLDAVRSMCHHSHKRLTACFQGQ
HGTDADKRHKKLPLTALAQNMQEASTQLEDSLLGRMLETCGDAENQLALELSQHEVFVEK
EIVDPLCGIAEVDIPNIQKQRKQLAKLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLK
EEMDEAGNKVEQCKDQLAADMYSFMAKEGEYSKFFVTLLEAQADYHRKALAVLEKALPEM
QAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIAAGASRLK
KLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFQLYEEWTQVASVQDQDKKL
QDLWRTCQKLPPQNFVNFRYYLIKFLAKLAQTSDINKMTPSNIAIVLGPNLLWARNEGTL
AEMAAATSVHVVAVIEPIIQHADWFFPGEVEFNVSEAFVPVAPPNSNHSSHTGNDSDSGT
LERKRPASMAVMEGDLVKKESFGVKLMDFQAYRRGGTLNRKHVSPAFQPPLPPTDGSTLA
PAGPEPPSQSSRAESSAGGGPVPSSACALEQGPSPGDSSPPKPKDSAATAVSTLAPGRNS
IQVASGQSQGQGQPPAGSHQLSVNPAHSSTGSSPHTLRRAVKKPAPAPPKPGNPPPGQPG
GQSAPGTAQQAPSLSLKPATGSPSPPVPHAGPAPGQPCATSQLCGPRRASGSLAPMQAPS
HPPPQPPTQAPQSQARPGEQGLEQPTHTPPRTPTPPSTPPLAKQSPGLPAAQHPAAGHPE
TAQPHAGTLPRPRPVPKPRNRPSMPPPPHPPGAHPAADGSLSSAVPTASKIVTDANSRVS
EPLRSVFPDLHADSDSKDVPGRLLLDMDNDTESTAL
Download sequence
Identical sequences G1NUC1
ENSMLUP00000000813 ENSMLUP00000000813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]