SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001242 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001242
Domain Number 1 Region: 297-554
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.2e-74
Family Hsp90 middle domain 0.00000413
Further Details:      
 
Domain Number 2 Region: 88-295
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-62
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000823
Further Details:      
 
Domain Number 3 Region: 583-700
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 2.88e-27
Family HSP90 C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001242   Gene: ENSMLUG00000001350   Transcript: ENSMLUT00000001352
Sequence length 706
Comment pep:putative scaffold:Myoluc2.0:GL429839:4378045:4408350:1 gene:ENSMLUG00000001350 transcript:ENSMLUT00000001352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFGQVEGVVAWWKGVRVVPGATVLSSYRKGKPVLCPWRAQVQSSCPRRNLALSFHIARPF
SSQAAEDQKEEPPHSIISSTETVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELIS
NASDALEKLRHKLVSEGQTLPEMEIHLQTDTERGTITIQDTGIGMTQEELVSNLGTIAKS
GSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSASPDSPGYQWLSDGSGV
FEIAEASGVRTGTKIIIHLKSDCREFASEARVRDVVTKYSNFVSFPLYLNGKRINTLQAI
WMMDPKDVGQWQHEEFYRYIAQAHDKPRYTLHYKTDAPLNIRSIFYVPEMKPSMFDVSRE
LSSSISLYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVL
QQRLIKFFVDQSKKDAETYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRYESSALPAG
QLTSLADYASRMQAGTRNIYYLCTPNRHLAEHSPYYEAMKQKNMEVLFCYEQFDELTLLH
LREFDKKKLISVETDIVVDHYKEEKFEDKSPADDRLSEKEMEDLMAWMRNALGSRVTNVK
VTLRLDTHPAMITVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHILIKKLSQLR
ESEPDLAQLLVDQIYENAMIAAGLVDDPRPMVGRLNNLLVKALERH
Download sequence
Identical sequences G1NVE9
ENSMLUP00000001242 ENSMLUP00000001242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]