SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001261 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000001261
Domain Number - Region: 89-148
Classification Level Classification E-value
Superfamily EF-hand 0.000133
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001261   Gene: ENSMLUG00000001376   Transcript: ENSMLUT00000001371
Sequence length 262
Comment pep:putative scaffold:Myoluc2.0:GL430052:577442:579831:-1 gene:ENSMLUG00000001376 transcript:ENSMLUT00000001371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWTMMFVLLLLLPLSQAAPRDGTTRNLQTQSERVRLCSEEPEGPPPQAIRAVLRRRAW
LGVSFLSSSDSSSELSFSPLVLLYLHSGHYDQSGQLDGLELMSMLTAALAPGTADSPTTN
PVVLVVDEVLETQDLNGDGLMTPAELVNFPGAAPRHSEHQEPPEPQDLGRQPPLAKSPSG
QEAQEALGPRGEEGQVEAGKEPLEPGQEAGEKAPGAGGEAGAQAEARDAGKEAEEQPGET
VEPKNPPSEFEVHAIQLENDEI
Download sequence
Identical sequences G1NVG3
ENSMLUP00000001261 ENSMLUP00000001261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]