SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001286 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000001286
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0373
Family TB module/8-cys domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001286   Gene: ENSMLUG00000001396   Transcript: ENSMLUT00000001402
Sequence length 129
Comment pep:putative scaffold:Myoluc2.0:GL429839:4962080:4963465:-1 gene:ENSMLUG00000001396 transcript:ENSMLUT00000001402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAPLRPLPRLLVLGLGLALLSAAAGEPVSGTTPCSRGSSWSEDLDKCMNCESCPALPH
SDFCRGCAGAPSASFGLLWPILGGALSLALVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPGAALIQ
Download sequence
Identical sequences G1NVI5
ENSMLUP00000001286 ENSMLUP00000001286 XP_006090530.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]