SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001556 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001556
Domain Number 1 Region: 430-1181
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.53e-248
Family Type II DNA topoisomerase 0.00000000000386
Further Details:      
 
Domain Number 2 Region: 32-261
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.2e-63
Family DNA gyrase/MutL, N-terminal domain 0.000000263
Further Details:      
 
Domain Number 3 Region: 254-414
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-39
Family DNA gyrase/MutL, second domain 0.0000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001556   Gene: ENSMLUG00000001686   Transcript: ENSMLUT00000001696
Sequence length 1602
Comment pep:putative scaffold:Myoluc2.0:GL429806:5173149:5217108:1 gene:ENSMLUG00000001686 transcript:ENSMLUT00000001696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFDQNNAAKKEESETANRNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQLMW
VYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNG
KGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETA
CKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRR
AYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLT
LSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKNHIWV
FINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQ
LNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYG
VFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQ
DQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHI
ENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRK
EWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGF
KPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNIN
LLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARRLFPIVDDNLLKFLYDDNQRVEPEWYI
PIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQEL
GQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHT
DTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEF
FDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGY
ESDPVKAWKEAQEKATEEEETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELI
KQRDSKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDLMAGMAGKAVKGKVGKP
KVKKLQLEETMPSPYGRRIVPEITAMKADASKKLLKKKKGDLDTTAVKVECDEEFSGTPV
EGTGEEALIQAVPINKGPKPKREKKEPGTRVRKRKASTSSGKPSAKKVKKRNPWSDDESK
SESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDNNDLEELKVKASPI
TNDEEDEFVPSDGLDKDEYTFSPAKSKATPEKSSHDKKPQDFGNLFSFPSYSQKSEDDSA
KFDSNEEDSASVFSPTFGLKQIDKVPSKTAAAKKGKPSSDTMPKPKRTPKQKKVETMNSD
SDSEFGIPKKTTTPKGKGRGARKRKASGSENEGDYNPGRKTTRPPSKKLKKTSFDQDSDV
DIFPSDFASEPPSLPRTGRARKEVKYFAESDEEDDVDFAMFN
Download sequence
Identical sequences G1NW71
ENSMLUP00000001556 ENSMLUP00000001556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]