SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001631 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001631
Domain Number 1 Region: 263-525,565-614
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-63
Family p120GAP domain-like 0.0000939
Further Details:      
 
Domain Number 2 Region: 571-713
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-35
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 114-253
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-28
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.77e-27
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001631   Gene: ENSMLUG00000001781   Transcript: ENSMLUT00000001786
Sequence length 809
Comment pep:putative scaffold:Myoluc2.0:GL430518:266625:290301:1 gene:ENSMLUG00000001781 transcript:ENSMLUT00000001786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKISSLNVRVVEGRALPAKDVSGSSDPYCIVKVDDEVVARTATVWRSLSPFWGEEYTVH
LPLDFHHLAFYVLDEDTVGHDDIIGKISLSREAIAADPRGIDSWINLSPVDPDAEVQGEI
YLAVQMLEDVRGRCLRCHVLKARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHW
DEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVEFPPKVLQQNPPNGWFRLLPFPRAE
EDSGGNLGALRLKVRLLEDRVLPSRCYRPLLELLMESVLQPAEEDVCSPLAVLEELTSGD
CRQDLATKLAKLFLGQGLAGPFLDYLTRRELARTTDPNTLFRSNSLASKSMEQFMKLVGM
PYLHEVLKPVISRVFEEKKYIELDPCKMDLGRTKRLSFKGPSSEEHVREASLGLLMGYLG
PTVDAIVGSVGRCPPAMRLAFKRLHRRVEERFPQDEHKDVKYLAISGFLFLRFFAPAILT
PKLFDLRDHHADPQTGRSLLLLAKGVESTSQCGAQVTDTLPYGGSGLHGNRESCSSPGPG
HAEPGWEGSLSPPLFPEAGGPARALVPPSVTVREGYLLKRKEEPGSLATRFAFKKRYFWL
SGETLSYSKSPDWQMRSSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGSGTLHTTYLQCK
NVNDLNQWLSALRKASAPNPDKLATCHPGAFRGARWTCCLQAELSAAGCSHTHSAVTLGD
WSDPLDPDAETQMVYRQLLLGRDQLRMKFLEDFNMDSSPEADMGACPDALAGQREAAARL
LEVLEDLDRAHEEFQRQEQRKAVSGPRGP
Download sequence
Identical sequences G1NWD2
ENSMLUP00000001631 ENSMLUP00000001631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]