SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001675 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001675
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 3.42e-18
Family S100 proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001675   Gene: ENSMLUG00000001839   Transcript: ENSMLUT00000001838
Sequence length 96
Comment pep:putative scaffold:Myoluc2.0:GL429918:931461:937255:1 gene:ENSMLUG00000001839 transcript:ENSMLUT00000001838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPLTEVETAIDTLVNAFFTFARREGRKGSLNINEFKEMATQQFPHLLKDVGSLDEKM
KSLDVNGDSELRFNEYWRLIGELAKEIRKEKEMQKK
Download sequence
Identical sequences G1NWG9
ENSMLUP00000001675 ENSMLUP00000001675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]