SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001911 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001911
Domain Number 1 Region: 127-321
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 755-866
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-38
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 3 Region: 444-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 328-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 5 Region: 891-984
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-31
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 6 Region: 616-706
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 7 Region: 548-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001911   Gene: ENSMLUG00000002093   Transcript: ENSMLUT00000002099
Sequence length 995
Comment pep:putative scaffold:Myoluc2.0:GL430095:94057:133515:1 gene:ENSMLUG00000002093 transcript:ENSMLUT00000002099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVARLPLPLLLGLLLLPRPGRPLDLADYTYDLGEEDDAEPLNYKDPCKAAAFLGDIAL
DEEDLRAFQVQQASDFRQRTIRRSSITAAVPGNTSTPSCQQANGQPRRRSPGRWRSRSRS
RRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVF
TYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVR
ENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPP
IGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGE
KIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRS
SSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQ
SFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKA
GFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEXAGLTGVTRK
GSGRPGWGSALRPPSLPPHRRAMWENGSFLQYRISLQFDFFETEGNDVCKYDFVEVRSGL
TADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSGLRELSDSWGHLM
SPCLAHRSPQPQPHQATCTSGLSLCVRKHSADSAGCDHKVTSTSGTITSPNWPDKYPSKK
ECTWAISSTPGHRVKLTFLEMDIESQPECAYDHLEVYDGRDAKAPVLGRFCGSKKPEPVV
ATGSRMFLRFYSDNSVQRKGFQAAHSTECGGQVRAEVKSKDLYSHAQFGDNNYPGGVDCE
WVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAG
DSVLVRFHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences G1NX28
ENSMLUP00000001911 ENSMLUP00000001911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]