SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002076 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002076
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000324
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002076   Gene: ENSMLUG00000002281   Transcript: ENSMLUT00000002281
Sequence length 1350
Comment pep:putative scaffold:Myoluc2.0:GL429952:2621743:2631107:-1 gene:ENSMLUG00000002281 transcript:ENSMLUT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRALGAVWRPVATPHCPPQELRRAELVEIIVETEAQTGVSGINVAGGGKEGIYIRELRED
SPAARSLSLQEGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPG
TVSGYEIKGPRAKVAKLNIQSLSPVKKKKMVVPGALGVPADLAPVDVEFSFPKFSRLRRG
LKAEAVKGPVPAAPTRRRLQLPQLRVREVAEEAQVARLAAAAPPHRKAKAEAEVAAGARF
TAPQLELVGPGLPSTEVGVPQVPAPKGLGAVEAATGFALHLPTLGLGAPAAPAVEPVAVG
IQVPQVELPTLPSLPSLPTLPCLETREGATAALTVPTLDVAVPAVGVDLALPGAEMESQE
EVPEVALKTPGFSFPRFGARAKEVAEVKVAKGSPEVRVKGPRLRMPTFGLSLLEARPTAP
EAVAESKLKLPTIKMPSFGIGVSAPEVKGPAVKLPKAPEVKLPKVPEAALPEVQLPEVAL
PKVSEMKLPKAPEMAVPNGAFQKVQLPKVSEDEAPKRVPKNGQCPRCDSQRVQLPKVSEM
KLLKGAREGLCRGAIARGAAPKFSEMKLPKVPEMTVPEVRLPEVALPKVSEMKLPKVPEM
AVPEVRLPEVQLPKSEMKLPKVPEMVVPEVRLPEVQLPKVSEIRLPEMQVKAPDVQLLKA
PEMKLPKAPEVQLKAAKAEKVEGVEFGFKMPKMTMPRFGRAGSPSRGKSGEAGAEVSGKL
VTLPCLQPEVDGEARVGVPSLTLPSVELDLPRALSLEGQVPVAEAGKVERAEQGKVAAGV
GEVAFRMPSVEIVTPQLPTVEVEEGRVEVMEMKVKPTSKFSLSKFGLSGPKVAKAEAEGA
GRATKLKTSKFAISLPKARVGTEVEAKGVGEAGLLPALDLSIPQLSLDAHLPTGKAEAAG
ADFKLKGPRFTLPKFGVRVRDTEAGELVPGVSELEGKGWGWDGRVKMPKLKMPSFGLARG
KEVEIQGGRVSPGEKAELMVGQLKIPEVELVTLGAQEEVGAEGAVAVSGARLSGLQVSTT
RQAGTEGQEEVRRMPLGISLPQVELTRFGEAGLGATSGQQAESAAPSAEGTAGYRVQVPQ
VTLSLPEAKGEGGELLVGEGVFKMPTVTVPQLELDVGLSREVQVGEAATDEGGLRLKMPT
LGARAGAGVGGPGDQPPGAERSFHLSLPNLELSPPAMGSHAEYQVVEGEGDDGHKLKVRL
PRFGLVRAKEGGEEGEKAKSPKLRLPRVGFSQSEAVAGESSPSPEEDEEEEEGSREGASG
RRGRLRVRLPRVGLATSSKASRGQEGEAASKSPGGEKSPKFRFPRVSLSPKARSGSRDRE
EGGFRVRLPSVGFSETGGSRPHQGWRALRL
Download sequence
Identical sequences G1NXH8
ENSMLUP00000002076 ENSMLUP00000002076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]