SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002117 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002117
Domain Number 1 Region: 5-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-57
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 221-263
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000968
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002117   Gene: ENSMLUG00000002334   Transcript: ENSMLUT00000002330
Sequence length 264
Comment pep:putative scaffold:Myoluc2.0:GL429814:3759741:3777657:1 gene:ENSMLUG00000002334 transcript:ENSMLUT00000002330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFWVERTPVHEAAHRGEALELQQLIESGACVNQVTVDSITPLHTASLQGQAQCVQLLLAA
GAQVDARNIDGSTPLCDACASGSIECVKLLLAYGAKVNPPLYTASPLHEACMSGSSECVR
LLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKN
VDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSASAKCFEHYEKTPLTLSQLCRVSLRKAT
GVRGLEKIAKLNIPPRLINYLSYN
Download sequence
Identical sequences G1NXL3
ENSMLUP00000002117 ENSMLUP00000002117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]