SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002460 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002460
Domain Number 1 Region: 44-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000914
Family EGF-type module 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002460   Gene: ENSMLUG00000002711   Transcript: ENSMLUT00000002707
Sequence length 152
Comment pep:putative scaffold:Myoluc2.0:GL429903:404477:422083:-1 gene:ENSMLUG00000002711 transcript:ENSMLUT00000002707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVILHCAVADGNSTRSPESDGLLCGDARGDCAVTTTQSKWNDYFSPCPKKYEHYCINGK
CRFVGALQTPSCLCDDGYAGARCERVDFFYLRGDTGQILVICLTAVMVTLIILVIGVCTC
CHPLRRKKKEDVPNLGKDITPVNEDIQETSIA
Download sequence
Identical sequences L7N137
ENSMLUP00000002460 ENSMLUP00000002460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]