SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002766 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002766
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.76e-23
Family Pyk2-associated protein beta ARF-GAP domain 0.0027
Further Details:      
 
Domain Number 2 Region: 27-60,113-207
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-20
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002766   Gene: ENSMLUG00000003040   Transcript: ENSMLUT00000003043
Sequence length 753
Comment pep:putative scaffold:Myoluc2.0:GL429924:2240512:2249628:-1 gene:ENSMLUG00000003040 transcript:ENSMLUT00000003043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWE
HSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQL
HSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPD
VNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADRLRS
RQKCMSQSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQNHTLVT
ERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSLSSPTDNL
ELSVRSQSDLDDQHDYDSVASDEDTDQEPLRSAGATRNNRARSMDSSDLSDGAVTLQEYL
ELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQIRQPPEPVPTPPLPSER
AEHSSMGPGGSAHRRDRQAFSMYEPGSALKPFGGPPGDELATRLQPFHSTELEDDAIYSV
HGPAGLYRIRKGVSASAVPFTPPSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPL
LGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFK
HDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAP
VDFQLLTQQVIQCAYDIAKAAKQLTITTREKKQ
Download sequence
Identical sequences G1NZ91
ENSMLUP00000002766 ENSMLUP00000002766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]