SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002852 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002852
Domain Number 1 Region: 41-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-34
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 171-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-16
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 297-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002852   Gene: ENSMLUG00000003137   Transcript: ENSMLUT00000003138
Sequence length 524
Comment pep:putative scaffold:Myoluc2.0:GL430453:223294:234068:1 gene:ENSMLUG00000003137 transcript:ENSMLUT00000003138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVSSVLPAVLLITVLVVEGIAVAQKPPDGQNVGVRHVAGTQCGIWVRTSNGGHFASPSYP
DPYPPNKECIYVLEAAPRQRIELTFDEHFYIEPSFECRFDHLEVRDGPFGFSPLIERFCG
VKSPPLIRSTGRFMWVKFSSDEELEGMGFRAKYSFIPDPDFTYLGGILSPIPDCQFELSG
ADGVVRSSQVEQEEKTKPGQAVDCIWTIRATPRAKILFYLRFLDYQMEHSNECKRNFVAV
YDGSSAIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFQRFLSPTAPCTG
STFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKRAGLFEQMTRTHGTIIGVAAGVVL
VLLVVSVLVQVKQPRKKVACKAAFHKPGFQEAFDPPHYELFSLRDKELAAELGELGEELD
GYRPLRRASSASRCVHEHHCGAAPGKPGRTDLAAAVELPFRNDFAPPPPMTTFNSTFPKS
RCAFPPARPGPEAAREDRVMEELPCEIYARGRDDSAQASISIDF
Download sequence
Identical sequences G1NZG2
ENSMLUP00000002852 ENSMLUP00000002852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]