SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002873 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002873
Domain Number 1 Region: 597-834
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.25e-80
Family Eukaryotic proteases 0.0000574
Further Details:      
 
Domain Number 2 Region: 96-226
Classification Level Classification E-value
Superfamily SEA domain 4.58e-22
Family SEA domain 0.0074
Further Details:      
 
Domain Number 3 Region: 240-360
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000811
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 4 Region: 364-470
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 5 Region: 476-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 553-592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 512-548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002873   Gene: ENSMLUG00000003149   Transcript: ENSMLUT00000003159
Sequence length 837
Comment pep:putative scaffold:Myoluc2.0:GL429904:1976387:2016983:1 gene:ENSMLUG00000003149 transcript:ENSMLUT00000003159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDVSSKPADVNISNISVQVMSAPGKLPGRPGRPGRPGRRPPRKPINKAQLKKQPK
KKAPFWNVQNKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFVGMFRITNIEFLPEY
RQKESREFLSVTRTVQQVVNLVYTTSAFSKFYKQSVIADVSSNNKGGLLVHFWIVFVMPH
AKGHIFCEDCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGPGK
ACSQYLYADHLSVRYPLEISATSRRLMCHFKLVAIVGYLIRLSIESVQIEADNCVTDSLT
IYDSLLPIRSTVLYRMCEPTRTLMSFVSTNNLMLVTFKSPQIRRLSGIRAYFEVIPEQKC
ENTVLVKEITGFEGKISSPYYPSYYPPKCKCTWKFQTPVSTLGIALKFHNYSITKKSVKG
CDHGWWEINEHMYCGSYMDHQTIFRVPSPLVHIQLQCSSKLSDKPLLVEYGSYNISQPCP
VGSFRCSSGLCVPQAQRCDGVNDCFDESDELFCVTLKPACNTSSFRQSGPLVCDGFRDCE
DGQDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCSCSGSASTLHR
IIGGTDTLEGRWPWQVSLHFIGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGM
YVQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSVAWPETLKQLIQPICIPPAGQKVR
SGEKCWVTGWGRRHEADNKGSPVLQQAEVELIDQTLCVSTYGIITSRMLCAGVMSGKRDA
CRGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVSWIHKYVPLL
Download sequence
Identical sequences G1NZH9
ENSMLUP00000002873 ENSMLUP00000002873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]