SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002896 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002896
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 177-224
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000732
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002896   Gene: ENSMLUG00000003187   Transcript: ENSMLUT00000003183
Sequence length 226
Comment pep:putative scaffold:Myoluc2.0:GL431556:12397:13077:-1 gene:ENSMLUG00000003187 transcript:ENSMLUT00000003183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANVLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPPGAPAFPAPPTEPASEVPEQPPAQPLPGNAPRRAYYIYSGGEKIPLVLS
RPLSSNVATLQHLCRKTVNGHLDTYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences G1NZK0
XP_006108262.1.53796 ENSMLUP00000002896 ENSMLUP00000002896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]