SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003043 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003043
Domain Number 1 Region: 85-263
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.66e-34
Family APC10-like 0.0022
Further Details:      
 
Domain Number 2 Region: 1700-1760
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000153
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1658-1709
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000671
Family ZZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003043
Domain Number - Region: 989-1075
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00222
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 1-40
Classification Level Classification E-value
Superfamily EF-hand 0.0311
Family Polcalcin 0.053
Further Details:      
 
Domain Number - Region: 2586-2675
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0353
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003043   Gene: ENSMLUG00000003340   Transcript: ENSMLUT00000003349
Sequence length 2841
Comment pep:putative scaffold:Myoluc2.0:GL430424:18846:113389:-1 gene:ENSMLUG00000003340 transcript:ENSMLUT00000003349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFAQFDAEGDGTVDAESMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEG
LGVHSSMILRFLHRNRLSSMVIPYPMLDHCNNMCTMRASVLKESLDELVQKEKESPGDLT
GSPEMDKLKSIAKCYAYIETSSNPTDIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVL
RHLSIAVASTDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANISQLYVQ
INIKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFV
QTVLRNTQKALQHMPPLSLSPGSTDGSTFLSPNVLEEVDSFLIRITSCCSTPDVELTLLA
FALARGSVAKVLSSLCTVTDHLDTHYDASSLISSMASVRQNLLLKYGKPLQLTLQACDVK
GKEEKSGPENLLVEPWTRDGFLTETGKTRASTIFSTATESALQVTQIRIMVRRGGIGAQC
GLIFAYNSSSDKFHAEEHFKRFEKYDKWKLKEFRQFVKSRIGCSPDDLGEDDPIGWFELE
EEWDEAEIKLQQCRVARYLMVKFLCTRQESAERLGVQGLSISGYLRPARAEAEQSAICAH
CRKDMEESVCGASLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLEIFWNFYSKL
KQNPREECICAQTLLLQLLQSCFLVLQRDATAASEDAKAPRQSPRAVEAAKELYTHLCDV
VDRVDGDSVPMEILKQEVRNTLLSGAAIFFPDRQTQRNHLFTMMKNVTEQEHKQSLQLTF
RSLCTYFSDRDPGGLLLLPEKGDLADTNIGEVLAVMRTLLSVAARECELLMLNKAQAEVG
SVLFSLFWSVQGSLLSWCYLQLKSTDPGAKELAIDLIEKYVEQFLGSTRSILESLLSQYS
GKTIVEKLCNSVFSMAARQLVIFLLDFCTLDISHCKLLREFSTLTELLKRLCSDPEGGLN
KLDVETWQQEQPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDY
LEFTDARGGKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPD
VAVSWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNMAVPQAKMALVLNSPLWKPVFRHQ
ICPELGLEASWPTHPQQDSKEVKNIPDDPCHRFLLDFAQSDPAQNFCGPYSELFKGFIQA
CRKQAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGTTALSEEFAQVYSL
ADGIRIWMLEIKQKSLVSLGNEAEEKRGSEAAEANPESLAKECIQKSLLLLKFLSMGISS
KESSDKLVTTDEPDHHLQPLDKRQRTSSVVEEHFQASASPTDTAPPAAGDRSPGLDVQPK
LPPSSGPPATEVSSATAEEPSSPSTPTRRPPFTRGRLRLLSFRSMKPEEARPVPTVKEKY
PVLRDVMDFIKDQSLSHESVVKVLSLRKAQAQSILEVLKIIQYCAEALGQPHCFHPPYIL
FLLELLTCQKEFTNYFGHLEGCGAALHKEIRDTYYRFVLFMVKAIKGFSSINDALSCVQT
ALLHLLDMGWEPSDLTFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEW
MDECQDGMFETWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQ
CSDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCY
AAKKYSYGHLPTHSITAHPMVTIRSSDRQRLIQPYIHNYAWLLFAALALYSAHLASSEEV
DGEKLDPRARSCAVTLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGNSTPGNQAPPV
IVPTRTAEEQLEKEAVQVAEEPADTGPFVHCNSREVKSTDSTQITWASHPGAKRSSEASR
PRSGRSPARAKTWVPDADNLGASSQKPVEEKAVTPSPEQVFAECSQKRILGLLAAMLPPL
KLDPTVPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPSEVDAAVIKVL
SAKHNLFAAGDNSIMPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWRD
VIATFTDHCIKQLPFQLKHTNIFSLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFT
EKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECSDSQAQLSQYSQHFAFIASHLLQTSMDS
HCPEAVEATWVLSLALKGLYKTLKAHDFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLL
RDLEILSIMLYSSKKEINTLAEHGDLESDERGDQEEEVERSVSSPSEPEQKKLDPLESLD
EPTRICFLMAHDALNAPLHILRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRALAQK
WQPSRSLRLEEQSAKAVDTDMIILPCLSQPTRCDKATAESNPVTQKLISSTESELQQSYA
KQRRTKSAALLHKELNCKSKRAVRDYLFRVNEATAILYARHVLASLLAEWPGHVPVSEDI
LELSGPAHMTYIFDMFMQLEEKHRWEKILQKVLQGCRENMLGTMALAACQFMEEPGMEVQ
VRESKHPYNNNTNFEDKVHIPGAIYLSIKFDPQCNTEEGCDELAMSSSSDFQQDRHNFSG
SQQKWKDFELPGDTLYYRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEERVVP
HLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVLCCNHSDLCDLSLLKPLWQLFTHMEY
SLFEDVTQPGILLPLHRALTELFFVTENRAQELGLLQDYLLALTTDDHLLRCAAQALQNI
AAISLAINYPNKATCLWNADC
Download sequence
Identical sequences G1NZY1
ENSMLUP00000003043 ENSMLUP00000003043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]