SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003084 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003084
Domain Number 1 Region: 1691-1873
Classification Level Classification E-value
Superfamily Smc hinge domain 7.06e-20
Family Smc hinge domain 0.0021
Further Details:      
 
Domain Number 2 Region: 126-255
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000249
Family DNA gyrase/MutL, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003084   Gene: ENSMLUG00000003378   Transcript: ENSMLUT00000003393
Sequence length 2005
Comment pep:putative scaffold:Myoluc2.0:GL429825:307732:452207:1 gene:ENSMLUG00000003378 transcript:ENSMLUT00000003393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGGGGPSAGTGRGGRGDRCRKVYLFDRRKKESEQGDRVVQVGERSDYAGFRASVRQT
LGISPEEKFVITTTSRKEITSDNFDETIKDGVTLYLLQSVDQLLLTATKERIEFLPHYDT
LVKSGMYEYYASEGQNPLPFALAELIDNSLSATSRNTGIRKIQIKLHFDETQGKPAVAVI
DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAV
FFVGQSARMISKPADSQDVHELLLSKEDFEKKEKNKESIYSGFIRNRKPCDSVHITNDDE
RFLHCLISEEKEKVSFTAVVITGVQSEHIPYLKNYFHLWTRQLAHIYHYYIHGPKGNEKR
TSKEVGPFNNIDIEISMFEKGKAPKIVNLREIQDDMQTLYINTATDSFEFKAHVEGDGVV
EGIIRYHPFLYDRETYPDDPCFPSKLKDEDDDDDCYIVEKAARGKRPIFECFWNGRLIPY
TSVEDFDWCAPPKKRGLVPIECYNRISGALFTNDRFQVSTNKLTFMDLELKLKDKNTLFT
RISNGQEQRVKIDREFSFWLKDCHEKYDKQIKFTLFKGISTRSDLPAKKQGPWATYSAIE
WDGKIYKAGQMVKTIKTLPLFYGSIEKFFLYGNHDGEVYATGGEVQIAMEPRALYDETKI
VPIAKLDRTFAEKAVKKYVEDEMARLPDRLSVTWPEGDELFPNEIRPAGTTIGALRIEIL
NKKGEAMQKLPGTGHGGSKKLLVELKVILHTSSGNKEIISHISQHGGKWPYWFKKMENIQ
KLGNYTLKLQVVLNESNADTYAGRPLPCKAIKFSVKEGKPEKFSFGLLDPPFRVGVPFNI
PLEFQDEFGHASQLINDIQPVLEASGLSLQYEEITKGPNCIIRGVTAKGPVNSCQGKNFN
LKVILPGFKEDSQILKIRLLPGPPHQLKVKPDSEFLVIENGTAFPFQVEVLDESDNITTQ
PKLVVHCKFLGAPNLPVYTVDCSSSGTSILSGPAIQVQNIKKDQTLKAKIEIPSCKDVAP
VEKTIKLLPSSHVARLQIFSVEGQKAIQIKHQDEVNWIAGDVMHNLIFQMYDEGEREIHV
TSTLAEKIKVNWTPEINKEHLLQGLLPDVQVPTSVKDMRYCQVSFQDDHVSLESAFTVRP
LPDEPKHLKCELKGAKTVQMGQELQGEIVVIVTDQYGNQIQAFSPSSLSALGIAGIGLDS
SQLKTTFQENTQSISVRGIKFIPGPPGNKDLCFTWREFSDFIRVQLISGPPAKLLLIDWP
ELKEFVPVINGKELQHPLIVQLCDQWDNPAPVPLVKINIIKANNLKLTPSNQQYKTDEKG
RANLGVFSVYANPRGKHTMQVKAIHNRNTIEGPIIKLMILPDPEKPIRLNVKYDKDTLFL
AGGTFTDFMITVISEDDSIIKNINPARITMKMWKHSNNGNRPPANAETFSCNKIKGNDKE
DGCFYFRDKAIPHKVGTYCIQFGFMMDKALILNSEQIIIDVQPNQPVKLVPKIQPATPAV
SNVHSVANRTLVKDLHLIITDDFNNQTGLDLVGTVIATIKGSNEEDTDTPLFIGKVRTLE
FPFVKGSANITSLVLAENSPGKDSTEYFIKFELQLPDLSRTLESYSLPFMFSNDVKKQQQ
MLAFAKQKDELSQSIEMYRTVFETSRQLIDEMKCQVEVAKSKEAQLRNELKTNNIDIPTT
QQVPHIEALLKRKILEQEELKKKPRRSCTLPNYTKSSGNILGKIAHLAQIEDDRAAMVIS
WHLASDMDCVVTLTTDAARRIYDETQGRQQVLPLDSIYKKNLPDWRRPLPHYRNGKLYFR
PIGDPVFARDLLTFPDNIEHCETVFGMLLGDTIILDNLDAANHYRREVVKITHCPTLLTR
DGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCLVLGQQIDLLQQYRNALDKLNSL
TKELNSELEYLQSPEMKKKKQELDEREKTLKLMEQHLLGVTPTRKGSDSLGHPTKVEMTD
CPIPPKRMRREVTRQNSKALTQKDT
Download sequence
Identical sequences G1P018
ENSMLUP00000003084 ENSMLUP00000003084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]