SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003109 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003109
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.41e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003109   Gene: ENSMLUG00000003422   Transcript: ENSMLUT00000003419
Sequence length 429
Comment pep:putative scaffold:Myoluc2.0:GL429826:2580079:2650947:1 gene:ENSMLUG00000003422 transcript:ENSMLUT00000003419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYE
ANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAVTNISSSDAPLQPLVASPSLQAAV
EKSKLEKEKEKKKEEKKREKEPEKPAKPLTTEKLQKKEDQQLEPKKSTSPKKAAEPTVDL
LGLDGPAEAPVTNGNTTTVPALNDDLDIFGPMISNPLPATVMPPAQGTSSVPAAATVSTV
TSGDLDLFTEQTTKSEEVTKKQLSKDSILSLYGAGTVQPQSAPGVFMGPTNIPFTSQAPT
AFQFPSMGVPVPAAPGLMGNVMGQSASMMVGMPIPNGFMGNAQTGVMPLPQNVIAPQGGM
VGQMGAPPTKFGLPQAQQPPWNLSQVNQQMAGMSMGSASPALGFAQPPSTTAGWSGSSSG
QTLSTQLWK
Download sequence
Identical sequences G1P043
ENSMLUP00000003109 ENSMLUP00000003109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]