SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003167 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003167
Domain Number 1 Region: 296-489
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.65e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 18-122
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000138
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 134-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000241
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003167   Gene: ENSMLUG00000003476   Transcript: ENSMLUT00000003480
Sequence length 1128
Comment pep:putative scaffold:Myoluc2.0:GL430037:783751:820341:-1 gene:ENSMLUG00000003476 transcript:ENSMLUT00000003480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESPSANMDTGAFLSSSMCSNRTLLIDSRVELKRGLQRQERHLFLFSDLFVVAKSKYNNN
FKIKNKIKLSDMWTASCVDEVGEGNTDAMKSFVVGWPTVNYVATFSSPELKDKWLSLLQR
YITLEKEKDYPKSIPLKIFAKDIGNCAYSKTITITNSDTANEVINMSLSMLGITGSDRDY
QLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDTALLTQESEDSTNPSSLQESFLMEQLPRE
MQCQFTLKPSRLAAALQLNDSGQKTFKRRRSIINWAFWRGSGTHLDNLPMSPTSPMTGQL
FGVSLTNICENDNLPKPILDILSFLNQNGPLTKGIFRQSANVKLCKELKEKLDAGGDVPL
DCESIFVIASVLKDFLRNIPRSVFSSDLYDQWVCVMDQGNDEERINTIQRLLDQLPRANI
VLLRYLFGVLHNIEQHASSNQMNAFNLAVCIAPSILWSSTTYSPELEGEFTKKVTLLIQF
VIENCCRIFGEEITSLFGEVSVRCDIRENTSDISCLQMTDSSYDSLENELNEDADAPCSD
LVMTLGQGSRSMDSVLTLSDYDPDQPELEGLLTLSDFDLDRPKHEDIQMEGPLESKPVTV
PGLYGEATLQDHGGAPSGAATPGYLSAAAADAPKSPRRQRRCSEPSIDYRDAKLSSFREF
YQKKLRKSSCDAILSQKGEDHLKQNEPPQEEGKAYFKQAPVTGTDIKKNASNKYAKKKGF
FGMEGSHVKRPPPSKPVAISVASCNYMSSHDCPRSQPVDADTPGHAPPHAADAPKSSKRH
RRCSETSIDDQHSKLSYLRGIFSRKHNKTSYEVRPLSGEEEYLQQHKSLQLEGQKLINQS
LVMGIEVGKSGATSQNTEKLLPSKLSICPRTSCSSLSSPGTSPSGSSVSSQDSAFSQISE
HSVFTPNETSSPVDCTFQAQSQQGEPADSSSSRLISGVPGPASEQASSRLDYSKKDTLQR
HAQMHSVTLHPSTWLRNGMASLKNWSLKNKARAARAEEKKTASLPGPAEPPPHASGAPEA
NPQQETQKDMPPTVPAGLAAAPTAQRDSSDPSHVAEPRGSSPSSLVEGTLELCLKSQEEG
ESSGPCSPGTPPCAISSPSSLVIDDEPSPDSGPAAVCDVEDTHSTKDI
Download sequence
Identical sequences G1P092
ENSMLUP00000003167 ENSMLUP00000003167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]