SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003184 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003184
Domain Number 1 Region: 300-429
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-43
Family Regulator of G-protein signaling, RGS 0.0000217
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-29
Family DEP domain 0.015
Further Details:      
 
Domain Number 3 Region: 227-289
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 8.76e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003184   Gene: ENSMLUG00000003492   Transcript: ENSMLUT00000003500
Sequence length 474
Comment pep:putative scaffold:Myoluc2.0:GL430368:48293:103825:1 gene:ENSMLUG00000003492 transcript:ENSMLUT00000003500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNQTSNMNVSESRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTI
EDPAVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVY
LCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKRAFWDVHR
PVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQEQ
INYWQIQLDRHRLKMSKVADSLLSYTEQYLDYDPFFVPPDPSNPWLSDDTTFWELEASKE
PSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRV
QEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFLRS
SAYQELLQAKKKSEPSMDRRTSFEKFAQNVGRNLPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences G1P0A9
ENSMLUP00000003184 ENSMLUP00000003184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]