SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003246 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003246
Domain Number 1 Region: 8-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.24e-51
Family DNA gyrase/MutL, N-terminal domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-32
Family DNA gyrase/MutL, second domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003246   Gene: ENSMLUG00000003552   Transcript: ENSMLUT00000003565
Sequence length 755
Comment pep:putative scaffold:Myoluc2.0:GL429962:1508536:1538046:1 gene:ENSMLUG00000003552 transcript:ENSMLUT00000003565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKCTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLANISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMKGYISNANYSVKKCIFLLFINHRLVESTSLKKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVESKLLGSNSSRTYFTQTLLPSLAGPSGEVV
KSTTGVTPSSASGSGDKVYGYQMVRTDSREQKLDAFLQPASKASQPQAIVPEDSTDTSRA
EQQDEEMPELPAPDGAAKSQSSEGIVTKGTLETSEKRGSPSIPDNPRKRHREGSNVEMVE
DESRKEMTAACTPRRRIINLTSVLSLREEINERGHETLQEMLHNHSFVGCVNPQWALAQH
QTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGP
KEGLAEYIVEFLKRKTEMLADYFSLEIDEEQEGNLIGLPLLIDNYVPPLEGLPIFILRLA
TEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQIEAPGSTPNPWKWTVEHVVY
KAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC
Download sequence
Identical sequences G1P0G5
ENSMLUP00000003246 ENSMLUP00000003246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]