SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003288 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003288
Domain Number 1 Region: 135-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-83
Family Protein kinases, catalytic subunit 0.000000325
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.27e-37
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003288   Gene: ENSMLUG00000003608   Transcript: ENSMLUT00000003611
Sequence length 541
Comment pep:putative scaffold:Myoluc2.0:GL430112:37557:86192:-1 gene:ENSMLUG00000003608 transcript:ENSMLUT00000003611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRDYCSLCDKQPIGRLLFRQFCEARPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKY
LTPKSPVFIAQVGRDLVSQTEEKLLQRPCKELFSACAQSVHDYLRGGPFREYLDSMYFDR
FLQWKWLERQPITKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGES
MALNEKQILEKVNSPFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERAL
FYAAEILCGLEDLHLENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTV
GYMAPEVLNNQRYGLSPDYWGLGCLLYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYS
HKFSEEAKSICKMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFIPDP
RAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEVSAGRPPRRWGRCGE
GAGTAGSGSRGLLASWVGQRAVQRIFKRQHQNNSKSSPNSKTSFNHHINSNHVSSNSTGS
S
Download sequence
Identical sequences G1P0K2
ENSMLUP00000003288 ENSMLUP00000003288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]