SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003293 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003293
Domain Number 1 Region: 147-283
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-24
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 264-360
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000457
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 77-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000571
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 386-483
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000814
Family Cadherin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003293   Gene: ENSMLUG00000003615   Transcript: ENSMLUT00000003618
Sequence length 1052
Comment pep:putative scaffold:Myoluc2.0:GL429860:2241373:2262181:-1 gene:ENSMLUG00000003615 transcript:ENSMLUT00000003618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIHLLSRQEIILIYLLIKVLVEVNSEFRIQVRDYNAKNGTIKWHSIRRHKREWIKFAAAC
REGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPFGIFVINQKTGEINITSIVDRE
VTPFFIIYCRALNLQGQDLERPLELRVRVLDINDNPPVFSMSSFLGQIEENSNANTLVMR
LNATDADEPNNLNSKIAFKIISQEPSDSPMFIINRYTGEIRTMNNFLDREQYSQYSLAVR
GSDRDGGADGMSADCECSIKILDVNDNIPYLEGSSYQIEIEENSLNSNLLQLRVIDLDEE
FSANWMAVIFFISGNEGNWFDIAMNERTNVGTLRIIKPLDYEAMKNLQLSIGVRNKAEFH
QSIMSQYKLTATAISVTVLNVIEGSVFRPGSKTFVVTSNMGQNYRVGDFIATDLDAGGPS
TKVRYRYVMGNNPADLLSVDSKTGIITLRNQVTMEQYNMLNGKYQGTILSIDDGLQRTCT
GTINIDLQGSGWKTSETTPKYNTDSEGGTGTGGGTGELTTGEVTVNTESNNGNGNVDGGV
TDDYKEPLGVPMFPDNVHFGPAGIGLLVMGFLVLGLVPFLLICCDCGGAPGGGAGFEPVP
ECSEGVIHPWAMEGPGPEPGIITTIPVPQIPPGGNIIQCVDTSGVYTNEYGGREMQEIEG
EERMTGFELEDGVKSSGAPEICQEYSGTLRRNSMRECREGLNMDFMESYFCQKAYAYADE
DEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDFDDSFLDTLGPKFKKLADISLGKNVE
SYPDFDLPWPESTEPIFPQQGTEPVASGRPPTSPCYGTTTVISESAYPSGPAVQHPMSIP
DPMSYGNVTVTESYATSGTLKPSVHIHDNRHASNVVVTERVVGPISGADLHGMLEMPDLR
EGSNVIVTERIIAPGSSLPATLTIPDPRESSNVVVTERVIRPTSGMMGGLSVHPDLSNAH
NVIVTERVVSGSGVTGFSGPAGSLVEAGIGGGGIGLSSLGGGGGLSSSMGGTATIGHMRS
SSDHHFSQTLGSTSPSTARSRITKYSSVQYTK
Download sequence
Identical sequences G1P0K6
ENSMLUP00000003293 ENSMLUP00000003293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]