SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003462 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003462
Domain Number 1 Region: 29-229
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.24e-55
Family DNA gyrase/MutL, N-terminal domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 209-364
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.33e-36
Family DNA gyrase/MutL, second domain 0.00000261
Further Details:      
 
Domain Number 3 Region: 669-847
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 6.28e-24
Family DNA mismatch repair protein MutL 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003462   Gene: ENSMLUG00000003795   Transcript: ENSMLUT00000003797
Sequence length 855
Comment pep:putative scaffold:Myoluc2.0:GL429975:1896974:1913425:-1 gene:ENSMLUG00000003795 transcript:ENSMLUT00000003797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEITGSFSTELAKVIKPIDRRSVHQICSGQVVLSLSSAVKELVENSVDAGATNIDLRLKD
YGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDV
TISTCHSSAKVGTRLVFDHNGKITQKTPFPRPRGTTVSVQQLFYTLPVRHKEFQRNIKKE
FAKMVHVLHAYCIISSGVRVSCTNQVGQGKRQPVVSTSGSSSIRDNIGSVFGQKQLQSLI
PFVQLPPSDSVCEEFGLSCSDALQNQFCISGFISHCTHGVGRSSTDRQFFFINWRPCDPA
KVSRLVNEVYHMYNRHQYPFVVLNISVDSGCVDINVTPDKRQIFLQDEKLLLAVLKTSLI
GMFDSDVSKLNISQQPLLDIEGHLLKPHWAETEKPLPEKQGSPASLGTRGAERRAVTISR
LREAFSLRHSAENRPQNRQVSPRQKRSVPSSRPSDALCPQKPCSGAGWTGPPGGGMSPDE
DREEAERDSGHGSTSAGSEEGFSTPDMGSHSSSDRAASSPEDRSSQEKMESCEKLPETGR
RFSDMECHLDPEDSGCKFRMWPQPTNLSNTKRLKKEGIPFSSDIPQKAVNMQNMSVSQVD
VAVKINKKIVPLDFSLSSLTTRVKQLHHQEQRRGEQNYRRFRAKICPGENQAAEEELRKE
ISKTMFAEMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTALQGQRLIRPQ
TLNLTAVNEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELI
FMLSDSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIAHMGEMDHPWNCPHGR
PTMRHIANLDVISQN
Download sequence
Identical sequences G1P0Z8
ENSMLUP00000003462 ENSMLUP00000003462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]