SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003604 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003604
Domain Number 1 Region: 5-298
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-83
Family Eukaryotic proteases 0.00036
Further Details:      
 
Domain Number 2 Region: 431-543
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 3 Region: 317-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-22
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003604   Gene: ENSMLUG00000003957   Transcript: ENSMLUT00000003958
Sequence length 567
Comment pep:putative scaffold:Myoluc2.0:GL429828:5717944:5734685:1 gene:ENSMLUG00000003957 transcript:ENSMLUT00000003958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMSKNKLFLLLGMICLEQGKSATLSLSKASTCGQSQVKAQPWNYLNGFSRIVGGSQVVK
GSYPWQVSLKRRQKHICGGTIISPQWVITAAHCVANRNIASSLNVTAGKHDLSHKEPGEQ
TLTIESIIIHPQFSTKKPMDYDIALLKMAGTFHFGPSVGPMCLPEPGEQFKAGLICTTAG
WGRLTENGILPQVLQEVNLPILTQEECVAALLTLNKPISGQTFLCTGFLDGGRDACQGDS
GGSLMCRNKRGTWTLAGVTSWGSGCGRGWRNNVQKDDQGSPGIFTDLSKVLPWIRKHIHI
GKRRKSSRAACREKDRVVRESEGELHFPESPYLYYDSKQLCVWTLLVPEDMHVLLSFSHL
DAESCDHNYLSMHSLEDRLLGKFCGESLVSSVLVASNSLRLKFISDATDYAVGFNLTYKA
LKPNYLPDSGCSSLAVLFEEGLIQSLHYPEDYNDMANCNWVFQAPKHYLIKLSFQNLEIE
ESGDCTSDYVTVHRDVERKKEIARLCGFAAPAPVLSSSGVMLISFQSDENVTFRGFQATV
SFIPETDLNISRSEAESMFLETWNVLP
Download sequence
Identical sequences G1P1C0
ENSMLUP00000003604 ENSMLUP00000003604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]