SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003734 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003734
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000122
Family HMG-box 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003734
Domain Number - Region: 167-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00181
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003734   Gene: ENSMLUG00000004095   Transcript: ENSMLUT00000004098
Sequence length 437
Comment pep:putative scaffold:Myoluc2.0:GL430620:31661:47295:-1 gene:ENSMLUG00000004095 transcript:ENSMLUT00000004098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRKATRNAYYFFVQEKIPELRRRGLPVARVADAIPHCSADWALLSQDEKEKYADMARA
WRAAQGKESGPSEKQKPVCTPLRKPGMLVPKQNVSPPDMSSLSLKNDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQDGIIADFHSFISPGEIPRGFRFHCQAASDSSHK
IPISNFESGCDQATVLQNLYRFIHPNPGKWPPIYCKSDDRARVNWCLKHMEKGSAMKEIR
QNLELLTVEDLVVGIYQQKFLKEPSKTWVRSLLDVAMWDYSSNTRCKWHEENDILFCALA
VCKKIAYCISNSLATLFGIQLTETHVPLQDYEASNRVTPKMVILDAGRYQKLRFESSGFS
HFNYSNQEPRSNTPTGDYPSGVKISGPNSSVRGRGITRLLERISGSSSSVPRFSSCDTAL
SPSLSPKGGYKSFSPLS
Download sequence
Identical sequences G1P1N3
ENSMLUP00000003734 ENSMLUP00000003734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]