SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003752 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003752
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.5e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 
Domain Number 2 Region: 130-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.51e-19
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003752   Gene: ENSMLUG00000004106   Transcript: ENSMLUT00000004119
Sequence length 759
Comment pep:putative scaffold:Myoluc2.0:GL429948:73399:119683:-1 gene:ENSMLUG00000004106 transcript:ENSMLUT00000004119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRLRSSEMCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
PLSSSKDNVELILKTINNQHSTESQDNDQPDYDSVASDEDTDLEATASKANRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAS
TKIYQVQTGSEYPDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPVGEANHPEESRTR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESTRRASRLEKQNSTPESDYDNTPNDTD
PDDMGSSRKGRQRSMVWQGDGSIPDMAEPSTAPSPILPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYTPCSERIHLAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DCSPPTDIQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences G1P1P9
ENSMLUP00000003752 ENSMLUP00000003752 XP_006096578.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]