SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003891 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003891
Domain Number 1 Region: 181-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-84
Family Protein kinases, catalytic subunit 0.000000283
Further Details:      
 
Domain Number 2 Region: 28-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.86e-43
Family Regulator of G-protein signaling, RGS 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003891   Gene: ENSMLUG00000004269   Transcript: ENSMLUT00000004272
Sequence length 586
Comment pep:putative scaffold:Myoluc2.0:GL429768:2241484:2251178:1 gene:ENSMLUG00000004269 transcript:ENSMLUT00000004272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHGGGQTQRLFAPTGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIG
RLLFREFCTTRPELTRCIAFLDEVAEYEVTPDEKRKACGQRLMQNFLSHTGPDLIPEVPQ
QLVTNCAQQLEKGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQPVTK
NTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNS
RFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLEDLH
RERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNERYT
FSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYSDQFSLQARSLCSQL
LCKDPAERLGCRGGGACEVKEHPIFKKLNFKRLGAGILEPPFKPDPQAIYCKDVLDIEQF
STVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQP
PAPPKKGLLQRLFSRQRTAVGTAATVKKSSPPASSPQSEAPTGGWR
Download sequence
Identical sequences G1P216
ENSMLUP00000003891 ENSMLUP00000003891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]