SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004188 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004188
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004188   Gene: ENSMLUG00000004600   Transcript: ENSMLUT00000004603
Sequence length 516
Comment pep:putative scaffold:Myoluc2.0:GL430553:183278:225910:1 gene:ENSMLUG00000004600 transcript:ENSMLUT00000004603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPSKQDILAILKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNAAASSFFDQHGCATGDTKAKYNSRAAQLYRDKIKSL
ASQAARKHGTDLWLDGCVTPPLSPAPKEDDFFASHTFPEVSGTGWASAHPEPSVTPRNVE
VPPANNEGGPEQGPSVEGLNLPTKAALEVSSIMKKKPSQAKRGLGAKKGSLGAQKLTSTC
FNEMEKQAQAVDKLKEQEDLARTAPKEESIVSSLRLAYKDLEIQVKNDEKKNMSGKTKAE
SERLGMGFGNCRSGISHSATSDMQTIEQETPVIAKPRKKYSDDNDDSYFTSSSRFFDDSM
ELRSSSFSSWDDSSDFYWKKKSTKEADTILKTTGYSDRPTTRRKPDYEPVGNTDEAQKKF
GNVKAISSDMYFGRQDHADGRVSSPRFRLCSVRRCVPAAVPGLEPEQQPQGNYNLSSVLP
TAPDMAQLKEGVRSVAGKLSVFANGVMTSIQDRYGS
Download sequence
Identical sequences G1P2T7
ENSMLUP00000004188 ENSMLUP00000004188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]