SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004219 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004219
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-41
Family Regulator of G-protein signaling, RGS 0.000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004219   Gene: ENSMLUG00000004638   Transcript: ENSMLUT00000004635
Sequence length 173
Comment pep:putative scaffold:Myoluc2.0:GL430022:1951645:1973770:1 gene:ENSMLUG00000004638 transcript:ENSMLUT00000004635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQSTLCFADIHDSDGSSSSSHQNPKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENV
LFWLACEDFKKTQDKKQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQ
KLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEEPPDTQTAAKRASRTYNT
Download sequence
Identical sequences G1P2W3
ENSMLUP00000004219 ENSMLUP00000004219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]