SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004234 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004234
Domain Number 1 Region: 20-257
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-46
Family Nuclear receptor ligand-binding domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004234   Gene: ENSMLUG00000004658   Transcript: ENSMLUT00000004652
Sequence length 260
Comment pep:putative scaffold:Myoluc2.0:GL429964:2202127:2204054:1 gene:ENSMLUG00000004658 transcript:ENSMLUT00000004652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSQPGTCPCQHAAGRPAILYALLSPSLGARPAVPPARRHCLCKQHRPVQLCAPHRTCR
EALDVLAKTVVFLRNLPSFCQLPSQDQQQLLRDCWSSLFLIGLAQDTVTFEVVEAPVPSI
LKKILLEEPSSSAGSGQQPDLPRPSLAAVQWLQCCLESFWSLELSPKEYAYLKGTILFNP
DMPGLHASSHIWHLQQEAHRALCEVLEPWCPAGQGRLARVLLMASTLKSIPPSLLGDLFF
RPIIGDVDIAGLLEDMLLLS
Download sequence
Identical sequences G1P2X5
ENSMLUP00000004234 ENSMLUP00000004234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]