SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004295 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004295
Domain Number 1 Region: 41-96
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000366
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 2 Region: 720-784
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 3 Region: 394-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000772
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 4 Region: 661-726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 601-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004295
Domain Number - Region: 947-1056
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000419
Family Spermadhesin, CUB domain 0.013
Further Details:      
 
Domain Number - Region: 343-399
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00654
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number - Region: 556-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0131
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004295   Gene: ENSMLUG00000004706   Transcript: ENSMLUT00000004720
Sequence length 1076
Comment pep:putative scaffold:Myoluc2.0:GL431789:2:16548:1 gene:ENSMLUG00000004706 transcript:ENSMLUT00000004720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSSGAASSSPLLDGTECGPPEWCSKGRCRSLAELTPMEAVHGHWSAWGPPSPCSRSCGG
GVVTRRRQCNNPRPAFGGRACTGADLQAEMCNTQACETTQLAFMAEQCAETEGRPLGLSP
GNASSYRWGPAVPHSQGDALCRHMCRAVGESFIMRRGDSFRDGTRCVPSGPQEDGTLSLC
VLGSCRTFGCDGRMDSRQVPDECQVCGGDNSTCSAQSGSFTGGRAREYVTFLTLTPNLTR
VHIANHRPLFTHLAVRIRGHYVVAGNFSISPSTSHPSLLEDSRIEYRVTLTEDRLPRLEE
ISIPGPTQEDMEIQVYRRYGEEYGNATRPHVTFTYFQPKLRAWAWAATRGACSVSCGAGL
RWVTYSCLDQARNQQVEAARCAGSPQPAAWPEPCAPGACPPYWAAGDFGPCSTSCGTGLR
ERAVRCVQAQGPRLRTLPPARCAALAQKPAVVETCSSQPCPARWEVSDACPLACGADLVA
QNVTCAQGADGLEAPATAGPCSADQTPAALEPCMAVACPPGWGPPDPQPLGEEAAPAPGG
PRLGARAAHVWTPLAGPCSVSCGRGQTELRFVCMDSALGTAVQEELCDLASKPGSRREVC
QAAPCPAWWRYKLAACSVSCGGGVARRILYCARAHGQDEDEEILPDTQCQGLPQPEPQEA
CSPEPCPPRWKVTSRGPCSASCGLGTATRSIACVRLDRGQDTEVDGAACAALARPRASIP
CVVADCTYQWHLSTWTQCSVSCGDGVQHRRDTCLGPRAQGPVPADFCQHLPKPATVRGCW
AGPCAGPGTPSLAPREEAAAPGQTTAGPAAASPEWPQPWARLLSQESPGGAGMSLPPRCL
GGWLQEGGRGCKARTTFHTPAPQSIRRPLGEVLTLQVLESSFQRAAPGEMLLLWGRLMWR
KVCRKLSGLTFSSKANTLVVTQRRVRLGGGGGVVLRFSSRPAPGAFHRECDTQLFGPRGE
IASPLASSDGRSVGGCRIFIDVAPWARIAIHALATDMGTEGAEASYISIRDIHSLKTTTF
RGQQALYWESEGSQAEMEFSQGFLDTHARLRGQYWTLQSRAPAPRTAPFWGGEEGS
Download sequence
Identical sequences G1P322
ENSMLUP00000004295 ENSMLUP00000004295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]