SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004343 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004343
Domain Number 1 Region: 57-213
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 1.57e-47
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000892
Further Details:      
 
Domain Number 2 Region: 219-400
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-35
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004343   Gene: ENSMLUG00000004771   Transcript: ENSMLUT00000004771
Sequence length 412
Comment pep:putative scaffold:Myoluc2.0:GL430520:75214:78616:1 gene:ENSMLUG00000004771 transcript:ENSMLUT00000004771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLASVLGSGPRVGPPLRPFLGPALLLRALSTSATDTHHVEMARERSKTVTSFYNQSAID
VAAEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQTEEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDIDLVIRISDRGGGIAHKDLDRVMDYHFTTAESSTQDPRINPLFGHLDMHSGVQS
GPMHGFGFGLPTSRAYAEYLGGSLRLQSLQGIGTDVYLRLRHIDGREESFRI
Download sequence
Identical sequences G1P364
XP_005882136.1.60319 XP_006106097.1.53796 XP_006106098.1.53796 XP_006106099.1.53796 XP_006106100.1.53796 ENSMLUP00000004343 ENSMLUP00000004343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]