SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004625 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004625
Domain Number 1 Region: 168-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-78
Family Protein kinases, catalytic subunit 0.00000065
Further Details:      
 
Domain Number 2 Region: 14-165
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.21e-40
Family Regulator of G-protein signaling, RGS 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004625   Gene: ENSMLUG00000005068   Transcript: ENSMLUT00000005071
Sequence length 547
Comment pep:putative scaffold:Myoluc2.0:GL430307:497116:537837:1 gene:ENSMLUG00000005068 transcript:ENSMLUT00000005071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGYGKKSGRSKKWREMLKLPPVSQCNELRQSIEKDYSSLCDKQPIGRLLFRQFCSTQYSL
QRCIEFLDAVAEYEVSPDEDRRERGQLVLNTFFNNENTAAPLPRIPARVVRACRLRLKEI
PSKELFKECVRVVHRYLSGKPFEEYQESPYFSRFLQWKWLERQPVTKKTFRHYRVLGKGG
FGEVYACQVRATGKMYACKKMLKKRIKRRNGEAMALNEKRLLEKVQSRFVVSLCYTYETK
DALCLVLTIMNGGDLKFHIYNLGSPGFNEQRAVFYAAELCCGLEDLQRERIAYRDLKPEN
ILLDDRGHIRISDLGLAMEVPEGETIRGRVGTVGYMAPEVINNEAYTYGPDWWGLGCLLY
EMIQGHSPFRRFKEKVKREEVERRVKEDTEEYSPRFSEDAESICRMLLTKDPKQRLGCQG
DGAAGVRKHPLFKNINFKRLEVHMVEPPFCPDAQRNAVYCKDIMDIEQFSMVRGIYLDAT
DTTFYSQFVTGSVSIPWQNEMIESECFKDINESENEETQDLRQEDKTCQPKPAPKRKRGF
FHRLLSR
Download sequence
Identical sequences G1P3W5
ENSMLUP00000004625 ENSMLUP00000004625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]