SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004628 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004628
Domain Number 1 Region: 259-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000353
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 2 Region: 386-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000219
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 425-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 235-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000991
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004628
Domain Number - Region: 204-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0382
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004628   Gene: ENSMLUG00000005071   Transcript: ENSMLUT00000005074
Sequence length 658
Comment pep:putative scaffold:Myoluc2.0:GL430500:238665:244932:-1 gene:ENSMLUG00000005071 transcript:ENSMLUT00000005074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTFTHMSIKPFRDSLSPEPPWTAPPAPPVLEVGSFSLPDGAGAHSAFSNPIRFPLGFTWP
GTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRADLKYSYRF
VCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWRGQYCTEAICLPGCDEQHGFC
DKPGECKCRVGWQGRYCDQCIRYPGCLHGTCQQPWQCTCQEGWGGLFCNQDLNYCTHHKP
CRNGATCTNTGQGSYTCSCRPGYTGATCEDEVDECGPSPCRNGGSCTDLENGFSCTCAPG
FYGSVCELSAMACADGPCFNGGRCSDNPEGGYTCHCPAGFSGFNCEKKVDACSSSPCANG
AQCVDLGDAYMCRCRAGFSGRHCQDNVDDCASSPCAHGGTCRDGVNEFSCTCPPGYSGRN
CSTPISRCEHAPCHNGATCHERARRYLCECARGYGGPNCQFLLPEPPPPAPEEYMEAGPF
PWVAVCAGAILVLVLLLGCAAAGVCVRLRLQKGPPLADPCHGETETMNNLASCQREKDVS
VSIIGATQIKNTNKKVDFHGDHGSGKNGPKARYPGVDYNLVPEPKGEDAASRDPHSKRDA
KCQLQGSPGEEKSTPTLRGRDASERKRRDSVYSTSKDTKYQSVFVISEKDECVIATEV
Download sequence
Identical sequences G1P3W8
ENSMLUP00000004628 ENSMLUP00000004628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]