SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004630 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004630
Domain Number 1 Region: 150-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-86
Family Protein kinases, catalytic subunit 0.00000000000301
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.51e-40
Family Regulator of G-protein signaling, RGS 0.0000000605
Further Details:      
 
Domain Number 3 Region: 517-627
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-26
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004630   Gene: ENSMLUG00000005075   Transcript: ENSMLUT00000005076
Sequence length 652
Comment pep:putative scaffold:Myoluc2.0:GL430182:689481:696964:-1 gene:ENSMLUG00000005075 transcript:ENSMLUT00000005076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLKHLEEAKPLVEFYEEIKRYEKLET
EEERLACSREIFDTYIMKELLACSHPFSKSATEHVQGHLVKRQVPPDLFQPYIEEICQNL
RGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMY
AMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGG
DLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLG
LACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTK
DKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVHRRLGCLGRGAQEVKESPFFRSLD
WQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERW
QQEVAETVFDTINAETDRLETRKKTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQ
RRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSD
PELVQWKKELRDAYREAQQLVQRVPKMKNKARSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences G1P3X0
ENSMLUP00000004630 ENSMLUP00000004630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]