SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004778 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004778
Domain Number 1 Region: 41-308
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-71
Family Nuclear receptor ligand-binding domain 0.00000995
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-20
Family Nuclear receptor 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004778   Gene: ENSMLUG00000005238   Transcript: ENSMLUT00000005237
Sequence length 324
Comment pep:putative scaffold:Myoluc2.0:GL429767:26599526:26607952:-1 gene:ENSMLUG00000005238 transcript:ENSMLUT00000005237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGQFTCQGCKSFFNRSVRDLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQR
GRMPPTQPNPGQYALTNDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENI
CELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAA
AGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAA
HIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPI
ETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences G1P4A4
ENSMLUP00000004778 ENSMLUP00000004778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]