SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004783 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004783
Domain Number 1 Region: 285-540
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.74e-111
Family Hsp90 middle domain 0.00000000856
Further Details:      
 
Domain Number 2 Region: 13-222
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-73
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000000554
Further Details:      
 
Domain Number 3 Region: 563-685
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 8.11e-41
Family HSP90 C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004783   Gene: ENSMLUG00000005239   Transcript: ENSMLUT00000005243
Sequence length 725
Comment pep:putative scaffold:Myoluc2.0:GL430008:138778:142978:1 gene:ENSMLUG00000005239 transcript:ENSMLUT00000005243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEEVVHHGEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESL
TDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQA
GADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGT
KVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEE
EDKDDEEKPKIEDVGSDEEDDSAKDKKKKTKKIKEKYIDHEELNKTKPIWTRNPDDITQE
EYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRR
VFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSEL
AEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKET
QKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKE
GLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWT
ANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLF
ETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASR
MEEVD
Download sequence
Identical sequences L7N184
ENSMLUP00000004783 XP_005861017.1.60319 XP_006098635.1.53796 ENSMLUP00000004783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]