SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004972 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004972
Domain Number 1 Region: 78-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.81e-48
Family Astacin 0.00032
Further Details:      
 
Domain Number 2 Region: 434-606
Classification Level Classification E-value
Superfamily TRAF domain-like 9.81e-41
Family MATH domain 0.00074
Further Details:      
 
Domain Number 3 Region: 272-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-27
Family MAM domain 0.0043
Further Details:      
 
Domain Number 4 Region: 678-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000342
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004972   Gene: ENSMLUG00000005449   Transcript: ENSMLUT00000005452
Sequence length 752
Comment pep:putative scaffold:Myoluc2.0:GL430048:436192:464354:1 gene:ENSMLUG00000005449 transcript:ENSMLUT00000005452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWTRATCILSFILFFAHIEAVSIKHHLKGNVHDAEFEEQKDISEINLDPPLAAGLDLFQ
GDILLRNSRNGLRDPNARWKFPIPYILADNLELNAKGAILYAFEMFRLRSCVDFKPYEGE
SSYIIFQQFEGCWSEVGDQHVGQNLSIGQRCDHKAIIQHEILHALGFYHEQSRTDRDDYV
EIWWDEVIPGHQHNFNTYEDSFITDLNTPYDYESLMHYAPFSFNKNESVPTITTKIPEFN
SIIGQRLDFSPIDLERLNRMYNCTTTHTLLDHCAFEKANICGMIQGTRDDADWDHEDSTR
PGQVDHTLVGQCTGAGYFMFFNTSSGLAEEAALLESRILYPKRKQQCLQFFYKMTGSPSD
RLAIWVRRDDGTGKVRKLVKMQTFQASCSQTWKIAHVTLREEKKFRYLFQGVKGDPQNSN
GGIYLDDITLTETPCPTGVWTVHNFSQVLQDTVKGSTILSPRFYNSEGYGFGLTLYPHGR
INSLSSGYLGLSFHLCSGENDAILEWPVENRQVIMTILDQEPDARNRMSSSMVFTTSKSH
TASAINGSVIWDRPTIVGTYDKDCKCYRSIDWGWSTFISHTMLKRRSFLKNDDLIMFVDF
EDITYLNQTEVTPRNTRLTPQGLVLQGQEQQDPEEGSAQASLETIPDSQGNGQPGRQKRS
AESTGPMEDHNWPPYFRDPCDPNPCQNEGLCVNVKGMASCRCVSDHAFFYTGERCQAMQV
HGSVLGLIIGGTAGVLFLTFTIISMRSKKLSQ
Download sequence
Identical sequences G1P4S7
ENSMLUP00000004972 ENSMLUP00000004972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]