SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005123 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005123
Domain Number 1 Region: 546-742
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 351-478
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-18
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 3 Region: 86-122
Classification Level Classification E-value
Superfamily WW domain 0.0000000538
Family WW domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005123
Domain Number - Region: 267-295
Classification Level Classification E-value
Superfamily WW domain 0.000509
Family WW domain 0.0047
Further Details:      
 
Domain Number - Region: 140-172
Classification Level Classification E-value
Superfamily WW domain 0.00556
Family WW domain 0.0055
Further Details:      
 
Domain Number - Region: 239-267
Classification Level Classification E-value
Superfamily WW domain 0.00801
Family WW domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005123   Gene: ENSMLUG00000005603   Transcript: ENSMLUT00000005609
Sequence length 745
Comment pep:putative scaffold:Myoluc2.0:GL430419:268745:294497:-1 gene:ENSMLUG00000005603 transcript:ENSMLUT00000005609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDDLGARRRAPPASRGARGSFKACSVAGSWVCPRPLGRSDSENTYETIEDVRGPPREERP
EQVDETPEPVYANIERQPLATSPVAAAAPGPGQVWETHTDADTGRPYYYNPDTGVTTWDS
PFEAAEDATSPAHSLSSVGSHESLETEWGQYWDEESRRVFFYNPVTGDKIWEEEAQELEE
EEEEDDDNDNTLKMQPGLSPGSPKDQRPPTPETDYPEVLTSYPEEDYCSSGSCSEPGPAS
PFVTPPGWSCHVDPEGQTLYTNQFTQEQWVKLEDQHGKPYFYNPKDSSVRWDLPQIPIPA
PRSILKSSQDSETPAQASPPEEKVSPEVGRVGSWEEISIAAVGAGTIKTLDKAGVLHRTK
TVDKGKRVRKKHWSTSWTVLEGGILTFFKDSKTSAAVGLRQPPKLSTPEYTVDLKGASLA
WAPKDKSSKKNVLELRSHDGSEYLIQHDSEAIISTWHKAIAQGIQELSADLPPEEESEHS
SVDFGSSERLGSWREDEARPGAAAAPVLSPGVQESDLSKVRQKLLKFLLKRPTLQSLREK
GYIKDQVFGCALATLCERERSPVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYK
VDHADERLDLEDGRWEDVHVITGALKLFFRELPEPLFHFSHFRQFIAAISETCAGERAGL
GVERPASRDPPHSPIAEPEFPAPHCRCRVIEYGEQNCPVQSVAIVFGPTLLRPETEEASM
PMTMVFQNQVVELILQQCSDIFPPH
Download sequence
Identical sequences G1P555
ENSMLUP00000005123 ENSMLUP00000005123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]