SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005277 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005277
Domain Number 1 Region: 46-60,178-344
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-37
Family Nuclear receptor ligand-binding domain 0.00000356
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000795
Family Nuclear receptor 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005277   Gene: ENSMLUG00000005775   Transcript: ENSMLUT00000005775
Sequence length 346
Comment pep:putative scaffold:Myoluc2.0:GL429940:1421038:1432579:1 gene:ENSMLUG00000005775 transcript:ENSMLUT00000005775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGFFKGPGARPTKPFPCPESQSCKIDKTQRKRCPFCRFQKCTVGMRLEAVRADRMRGGRN
KFGPMYKRDRALKQQKKAQIRANGFKMETGPPAGVPPPPPPPPDYLLPPGLHAPEPKGLA
SGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPTFPGRAIKSEYPEPYASPPQPGPPYGY
PEPFSGGPGVPELILQLLQLEPDEDQVRARILGCLQEPTKGRSEQPAPFSLLCRMADQTF
ISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQIQHGKEDSILLVIGQEVEL
STVAAQAGSLLHSLVLRAQELVLQLHALQLDRQEFVCLKFLILFSL
Download sequence
Identical sequences G1P5I6
ENSMLUP00000005277 ENSMLUP00000005277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]