SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005303 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005303
Domain Number 1 Region: 1006-1122
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-20
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 
Domain Number 2 Region: 644-765
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-18
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 3 Region: 835-963
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.3e-18
Family Regulator of G-protein signaling, RGS 0.0086
Further Details:      
 
Domain Number 4 Region: 400-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000028
Family Regulator of G-protein signaling, RGS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005303   Gene: ENSMLUG00000005800   Transcript: ENSMLUT00000005805
Sequence length 1251
Comment pep:putative scaffold:Myoluc2.0:GL430061:243278:333693:1 gene:ENSMLUG00000005800 transcript:ENSMLUT00000005805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPKEITLEIVSITLYFYEDSLATDNFLVDYFNEFLSLPTFSEAIRFNVNYGVFEVVNNAP
QLLEKQLKKILQSQQPRNPIYDVVRKAKNDTKPAQMSDPCKAETININYSVMCLNREQGI
QWIKKERLPAFLESDCYFEYRLAKLVSQVRWSRSGMNITLDKTFSPWVTRKVPTPPPPVI
EDDNAIIMKKFYISLGKASYLETKDWFTLAKQSQQTVSTFPALHSKADSPRLSSFSESVI
FDDGVHPRMQRDSSKATRIISELEEEEEEGSIALPDTPSHALLRIYLEKQPDTESQTFHF
STCEEFLISYINFILAVVINQIIGEPFREGPGYINFNNITEVIVDECELITVKSDVFPET
AQPTKEKAEERLKEAGSKQESRGSESRADWCISHKTYDIGNRKEFERFKAFMKGTLGERY
WWLWMDIERLKVLKDAGRHQRHLEKMKKSYLVSSGDRYLSTEILTKLKLLDGSQWNKEHL
INIQTEVVKPLLLYWAPRFCVTHSSAIRKASAELKLWHRRQEKPREDIDPFPQIATLLPL
RPKSCIPQISDTEKEESSLVPTPTSPKKPSTASQKPGKDETQRFISPKDSVTEKGSKQMS
ERCNVIHLTSYTDISECLKPELERRFTYSEEPLVKTMADGALGGSDMENLLQSLYVENRA
GFFFTKFCEHSGNELWKNSVYFWFDLQAYHQLFYQETLHPFKVCKQAQLLFATYVAPSAT
LDIGLQQQKKKEIYMKIQPPFEDLFDTAEEYILLLLLEPWTRMVQLDQHAYKQVKLVEET
RQLDSVNFRKLQALYKETVFKKAEDATSEIGTGIPPHPATTKSIENWNIVPAEYKNFNFN
TLLNNKLEFEHFRQFLEAYSASIDLMCWADIEQFRSIPYKDRKLREAKSIYIKNKYLNKT
YFLGPTSPASPYQQDQIMSLCGGWGKTLHEQLDPPVFVEVQKHVLKRLENVWLPLFLASE
QFAARQKIKLQLKEATDELLLQKHEEKIGTWKPVESKWISSSSEIIAFRKALLNPVTANQ
FQRFVALKGDLLENGVLFWQEVQKYKDLCHSHCDESIIHRKVMTIINCFINSSIPPALQI
DIPVEQAQKIIEHRKELGPYVFREAQMTIFGVLFKFWPQFCEFRKNLTDERIMSALERRK
EYQRQKKRSTIVEEERIQKEGFKQPEHVPVTPMKPSDLFSDQSLILQAYGRQPSWCYSKY
IEALEQERILLKVQEEIEKKLFTGGLSLTNVKPNSSGTSLKKTLSSQSNQS
Download sequence
Identical sequences G1P5K9
ENSMLUP00000005303 ENSMLUP00000005303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]