SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005443 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005443
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-34
Family DNA gyrase/MutL, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 1150-1364
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 7.72e-22
Family DNA mismatch repair protein MutL 0.014
Further Details:      
 
Domain Number 3 Region: 195-349
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.31e-17
Family DNA gyrase/MutL, second domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005443
Domain Number - Region: 1037-1067
Classification Level Classification E-value
Superfamily WW domain 0.0321
Family WW domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005443   Gene: ENSMLUG00000005949   Transcript: ENSMLUT00000005956
Sequence length 1414
Comment pep:putative scaffold:Myoluc2.0:GL430002:1334963:1362369:1 gene:ENSMLUG00000005949 transcript:ENSMLUT00000005956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKCLSAEVQAKLRSGLAICSLGQCVEELALNSIDAEAKCVAVRVNMEIFQIQVIDNGFG
IGSDDVDKVGNRYFTSKCNSLQDLENPRFYGFRGEALASIADMASAMEISSKKNGTMKTF
VKLFQNGKALNAFEADLTRPSAGTTVTVYNLFYQLPVRRRCMDPRLEFGKVRQRIEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDICSRFCQIYGLSKSQKLREINFKYKEFELSGYIS
SEAHYSKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICKPKNGSASRQMNSSPRHRSHP
ELHGIYVINIQCQFCEYDVCMEPAKTLIEFQNWDTVLVCIQEGMKMFLKKEKLFVELSGE
DIKELSEDNDFSLFSATFQKHMSSDEKCDRVSFQEACNNILDSYEMFNLQSKAVKRKATE
NINTQNSRNSEAIRKQTNDSFLYTYESDSPGHSKMTESTLQNKDSSCSESRVLEQERPEA
SESGENEKHKKYCLELNSLENPCGTNSEMPASPFQTLDHFEESGDLEIQKASTTVNDMAA
DILKKNRIQIQLETFKGATEMGCQPLPSETTLLRVHGAQGEEEKRKKEPSNCGRNVFSYG
QIKLCSTGFITHVVQNEQTETEHLFKNCVRPGPVSAKETLGNRTCHSVETPNIKDLTSTL
STEFAQLSNKKLCRTNISSRLENKPIPTYKNFAILQDGSKKSHTGGLLLDTSSFSWCRHV
SNDSKRKDKLIGLSRPIAPKKLSLNPQLGSLEKFKRQYGKVKNPLNTEVEENNNFEITTN
LRPQVEPDIPCRDKNHIDNSGMCKITTMEHNDSNSSCQPISHILYSGNFPFSKEEDCLEQ
QMPCSRESPVTLKDLCHLNRKPLDIEKSPESLASKLSKMKGSERETQIMEMSHFIERPQS
DSSRKDSDLCSGLSLDACMLFQNEHKNTESIILPMPDSVTQDNSFNKDSEAYSNNTTENS
VIPETSLVVHYNSAALSKDSDVLTVSEQQMGSPNSPSRMLMSHKDDSTANPNGTCFQNEE
SIATCSENEESNTCSLDWQQHFDVALGRMVYINKITGLSTFIAPTEDIRAACTKDLTTVA
VDVILKNDTVDDAVGSESLQSLFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILFPY
RFTKDMIHSMQVLQQVDNKFIACLMSTKTDEIGEAGGNLLVLVDQHAAHERVRLEQLIID
SYEKQQPQGSGRKKLLSSTVSPPLEITVTEEQRRLLWCYHKNLEDLGLGIIFPDTSDSLV
LVGKVPLCFVEREANELRRGRSTVTKSIVEEFIREQVELLQTTGGIQGTLPLTVQKVLAS
QACHGAIKFNDGLSLEESYRLIEALSWCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNL
AKLRKMAQAWRLFGKEECDTRQSLQVSMPPCEPL
Download sequence
Identical sequences G1P5Y3
ENSMLUP00000005443 ENSMLUP00000005443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]