SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005637 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005637
Domain Number 1 Region: 405-698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.44e-82
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 27-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-33
Family Spermadhesin, CUB domain 0.0000213
Further Details:      
 
Domain Number 3 Region: 187-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-31
Family Spermadhesin, CUB domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 303-373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000681
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 5 Region: 137-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005637   Gene: ENSMLUG00000006168   Transcript: ENSMLUT00000006172
Sequence length 702
Comment pep:putative scaffold:Myoluc2.0:GL429781:7596969:7653785:1 gene:ENSMLUG00000006168 transcript:ENSMLUT00000006172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSFRWLPLYHALCFSLWKALAHTVELNNMFGQIQSPGYPDSYPSDSRVTWNITVPEGFR
IKLYFMHFNLESSYLCEYDFVKVETEDQLLAIFCGSENTDTEHTPGQEMVISPGSFMSIT
FQSDFSDEERFTGFDAHYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYILHTD
NRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECFYAIRLEEGFMISLQFEDIFDIEDH
PEVPCPYDYIKIIAGPKVLGPFCGEKSPEPINTQTHNVSIQFRSDNSGENRGWKLSYKAT
GKECPGLRPPVQGKIEPLQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGSWSN
EIPICKIADCGAPAELEHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMYNNITGIYTCSAQ
GVWTNEVLGRSLPTCLPVCGLPKFSRKLIARIFNGRPADKGTTPWIAMLSHPNGQPFCGG
SLLGSNWILTAAHCLHHSLDPEDPILHDFYLLSPSDFKIIMGKHWRHRSDETEQHLRVKH
IFLHPQYDPNTFENDVALVELSKGPVLNDFVMPICLPESSSEEGTMVIVSGWGKQFLQRF
SETLMEIEIPIVDHRTCQEAYAPLKKKVTRDMICAGFKEGGKDACAGDSGGPMVTLDNET
GQWYLVGTVSWGKDCGKKDLYGVYSDIYSNKNWIQRVTSMKN
Download sequence
Identical sequences G1P6E5
ENSMLUP00000005637 ENSMLUP00000005637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]