SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006492 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006492
Domain Number 1 Region: 377-699
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-90
Family p120GAP domain-like 0.0000305
Further Details:      
 
Domain Number 2 Region: 251-361
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000164
Family PLC-like (P variant) 0.082
Further Details:      
 
Domain Number 3 Region: 178-250
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000238
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006492   Gene: ENSMLUG00000007105   Transcript: ENSMLUT00000007113
Sequence length 1213
Comment pep:putative scaffold:Myoluc2.0:GL429821:3875679:4000693:1 gene:ENSMLUG00000007105 transcript:ENSMLUT00000007113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVKGPPTHRLSCGQSPYTDTTTWERKYCILTDSQLVLLNKEKEIPTEGGQEQQADSTKGR
CLRRTVSVPSEGQFPEYPPEGTTKLEVPAERSPRRRSISGTSTSEKPNSMDTAYTSPFKV
PGFFSKRLKGSIKRTKSQSKLDRNTSFRLPSLRNTDDRSRGLPKLKESRSHESLLSPCSA
VECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSCNSASERDKWMENLRRTVQP
NKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFY
SLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPSASVTGRQFVEKWYPVSTPTPNKGKT
GGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHIL
QSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIK
ALYESDENCEVDPSKCSSSELIDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQ
CLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVIQNLAN
FAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNTPGFDGYIDLGRELSVLHSL
LWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGL
QKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDEKEGSLPNGRS
ISLMDLQDTHAAQVEHASVMLDVPLRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPL
HPALNQPGSLQPLSFQNPVYHLSNPIPAMPKASVDSSLENLSTASSRSQSNSEDFKLSGP
SNSSMEDFSKRSTQSEDFSRRHTMPDRHIPLALPRQNSTGQAQIRKMDQAGLGARAKAAP
SLPHSASLRSTGSMSVASAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQS
PVDSATMSPVERTAAWVLNNGQYEEDVEETEQNQDEAKHAEKYEQEITKLKERLRVSSRR
LEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQMKSIISRLMAVEEELKK
DHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGLSPTNPTKL
SITENGEFKNSSC
Download sequence
Identical sequences G1P8I7
ENSMLUP00000006492 ENSMLUP00000006492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]