SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007041 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007041
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 119-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000106
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007041   Gene: ENSMLUG00000007707   Transcript: ENSMLUT00000007711
Sequence length 491
Comment pep:putative scaffold:Myoluc2.0:GL429804:8353343:8363025:-1 gene:ENSMLUG00000007707 transcript:ENSMLUT00000007711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVKCGGVLSAPSGNFSSPNFPGLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDACGFD
FLEIYNGAAGDQGNLLGRFCGQVPPPPFTSSWHIMSVVFHSDKHVASRGFSAGYQKDVCG
GVLTGLSGVLTSPEYPNTYPNNAECRWVIRLPAASGLEDSPASIRGDTQFSATEIIVGDG
GPINPGCPDTRAPSLSSHQSPLAFSYTHPSRHCPIHTHTQTHTHTDTHTQTHTHRHTHTH
TDTHTQTHTHTQTHTQTHTHRHTHTHTCVLAQTQHLSRTVLAGREQGAPGRELPGTWRSN
QQTVAFIMIKVPAPKASSSFLLSPVVPMNVSCSRMDFQILISTQALAPLGQTQVYLGSRR
CAAQEVGGTFRIQARFDTCGTESQRRNNTSVIVSTLYIDFSASGQDIHQYEVLCEPRRKE
ASVHLLSGSDWLGPYAATAEHLQEAPPSDEAEEPESPVALVAQDTSDIVFLGLCILAGVL
MVMAIVVLMLL
Download sequence
Identical sequences G1P9W4
ENSMLUP00000007041 ENSMLUP00000007041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]