SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007100 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007100
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-17
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 2 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-16
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007100
Domain Number - Region: 229-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000201
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number - Region: 80-129
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0759
Family Pyk2-associated protein beta ARF-GAP domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007100   Gene: ENSMLUG00000007774   Transcript: ENSMLUT00000007775
Sequence length 305
Comment pep:putative scaffold:Myoluc2.0:GL431597:27262:29450:1 gene:ENSMLUG00000007774 transcript:ENSMLUT00000007775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNMNFEDVAIVFSEEEWGLLDEAQRLLYCNVMLEVFALVSSTGCCHKTDDEETCSEQSVS
VQGESQVRTSKTEPATQRTHLCKRCFSLFKNIVHLTESQAAYLEQKAFFNDTNVRDFCFS
ANLRQQQRKASGEKPWKEAVDRASFVTRCSFYLSGLPSSRREVGEDLPAISELLQQKAPL
DTEESHSGSESSQKLLSGKCHNKWGQCENAASHNQKVVQQSVCKRDVNYAWKKSGNIFRG
ISSLIGHRKVHSGQKPYECSDSGKAFGCKTNLNQHHRLHTGRKPHVCSGCGKSFKYISDL
NRHQR
Download sequence
Identical sequences L7N1E9
ENSMLUP00000007100 ENSMLUP00000007100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]